Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

S100P Binding Protein (S100PBP) antibody

Antigen

S100P Binding Protein (S100PBP)

Synonyms FLJ12903, S100PBPR, DKFZp313K2325, AI851343, S100pbpr, 4930429A08Rik, MGC128690, s100pbpr, MGC132224
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503879
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name S100PBP
Gene ID S100PBP
UniProt A8MTZ6
Immunogen The immunogen for anti-S100PBP antibody: synthetic peptide directed towards the middle region of human S100PBP
Sequence ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIA HIEDPEDTNQ
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-S100PBP antibody concentration is 1 mg/ml.
Description The specific function of this protein remains unknown.
Characteristics Antigen Size: 341 amino acids
Molecular Weight 37kDa

Application Details

Application Notes WB Suggested Anti-S100PBP Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Deng, Shi, Wilkerson et al.: "Usefulness of S100P in diagnosis of adenocarcinoma of pancreas on fine-needle aspiration biopsy specimens." in: American journal of clinical pathology, Vol. 129, Issue 1, pp. 81-8, 2007 (PubMed).

Alternatives

Alternatives for antigen "S100P Binding Protein (S100PBP)", type "Antibodies"
Hosts Rabbit (22)
Reactivities Human (21), Mouse (Murine) (18), Rat (Rattus) (18), Hamster (1)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (7), ELISA (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (1), C-Term,AA 378-408 (1), Internal Region (1)