Histone H2B Type 2-F (HIST2H2BF) antibody

Antigen: Histone H2B Type 2-F (HIST2H2BF)

Synonyms: FLJ35099, FLJ56780, FLJ56787, MGC131639

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Chicken, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN503884

Additional Information

Alternative name: Histone H2B type 2-F

Gene ID: HIST2H2BF

UniProt: Q5QNW6

Immunogen: The immunogen for anti-HIST2H2BF antibody: synthetic peptide directed towards the N terminal of human HIST2H2BF

Sequence: MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSV YVYKVLKQVH

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HIST2H2BF antibody concentration is 1 mg/ml.

Description: HIST2H2BF is the core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Characteristics: Antigen Size: 126 amino acids

Molecular Weight: 14kDa

Application Details

Application Notes: WB Suggested Anti-HIST2H2BF Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HIST2H2BF Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Small Intestine

Publications

Product: Kim, Sprung, Chen et al.: "Substrate and functional diversity of lysine acetylation revealed by a proteomics survey." in: Molecular cell, Vol. 23, Issue 4, pp. 607-18, 2006 (PubMed).