Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503894

Fas Apoptotic Inhibitory Molecule (FAIM) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FAIM1, EG623459, FAIM, faim
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503894
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAIM antibody: synthetic peptide directed towards the N terminal of human FAIM
Sequence MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEI RKEWMFKLVG
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against FAIM. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAIM
Background FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.
Molecular Weight 24kDa
Gene ID 55179
NCBI Accession NP_001028202, NM_001033030
UniProt Q9NVQ4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAIM antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Segura, Sole, Pascual et al.: "The long form of Fas apoptotic inhibitory molecule is expressed specifically in neurons and protects them against death receptor-triggered apoptosis." in: The Journal of neuroscience : the official journal of the Society for Neuroscience, Vol. 27, Issue 42, pp. 11228-41, 2007 (PubMed).

Alternatives for antigen "Fas Apoptotic Inhibitory Molecule (FAIM)", type "Antibodies"
Hosts (41), (8)
Reactivities (45), (29), (22), (15), (11), (11), (11)
Applications (39), (19), (9), (8), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon