Chromosome 18 Open Reading Frame 32 (C18orf32) antibody

Antigen: Chromosome 18 Open Reading Frame 32 (C18orf32)

Synonyms: FLJ23458, DKFZp469M0119

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN503896

Additional Information

Alternative name: C18orf32

Gene ID: C18orf32

UniProt: Q8TCD1

Immunogen: The immunogen for anti-C18orf32 antibody: synthetic peptide directed towards the middle region of human C18orf32

Sequence: PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTK GPTEICDKKK

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-C18orf32 antibody concentration is 1 mg/ml.

Description: The function of this protein remains unknown.

Characteristics: Antigen Size: 76 amino acids

Molecular Weight: 9kDa

Application Details

Application Notes: WB Suggested Anti-C18orf32 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-C18orf32 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate

Publications

Product: Matsuda, Suzuki, Honda et al.: "Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways." in: Oncogene, Vol. 22, Issue 21, pp. 3307-18, 2003 (PubMed).