Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503899

Chromosome 9 Open Reading Frame 68 (C9orf68) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C9orf68, bA6J24.2, MGC131199, MGC146453
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503899
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C9orf68 antibody: synthetic peptide directed towards the middle region of human C9orf68
Sequence CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQ PLLRERFHPG
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against C9orf68. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C9orf68
Background The specific function of this protein remains unknown.
Molecular Weight 45kDa
Gene ID 55064
NCBI Accession NP_001034484, NM_001039395
UniProt Q8N4H0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C9orf68 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Alternatives for antigen "Chromosome 9 Open Reading Frame 68 (C9orf68)", type "Antibodies"
Hosts (15), (2)
Reactivities (16)
Applications (10), (8), (3), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1)
Beacon