Chromosome 9 Open Reading Frame 68 (C9orf68) (Middle Region) antibody

Details for Product No. ABIN503899
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C9orf68, bA6J24.2, MGC131199, MGC146453
Epitope
Middle Region
(2), (1)
Reactivity
Human
(16)
Host
Rabbit
(15), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (8), (3), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN503899
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C9orf68
Sequence CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQ PLLRERFHPG
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against C9orf68. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C9orf68
Background The specific function of this protein remains unknown.
Molecular Weight 45 kDa
Gene ID 55064
NCBI Accession NM_001039395, NP_001034484
UniProt Q8N4H0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 392 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 9 Open Reading Frame 68 (C9orf68) (Middle Region) antibody WB Suggested Anti-C9orf68 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Hosts (15), (2)
Reactivities (16)
Applications (10), (8), (3), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top