SNF Related Kinase (SNRK) antibody

Antigen: SNF Related Kinase (SNRK)

Synonyms: HSNFRK, FLJ20224, KIAA0096, DKFZp779A1866

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN503916

Additional Information

Alternative name: SNRK

Gene ID: SNRK

UniProt: Q9NRH2

Immunogen: The immunogen for anti-SNRK antibody: synthetic peptide directed towards the middle region of human SNRK

Sequence: SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEG DGGGQSKPSN

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SNRK antibody concentration is 1 mg/ml.

Description: SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.

Characteristics: Antigen Size: 765 amino acids

Molecular Weight: 84kDa

Application Details

Application Notes: WB Suggested Anti-SNRK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-SNRK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human heart

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).