Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)

ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A (ATP6V1A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
HO68, VA68, VPP2, Vma1, ATP6A1, ATP6V1A1, Atp6a1, Atp6a2, AI647066, Atp6v1a1, atp6a1, atp6v1a1, ho68, v1a, va68, vma1, vpp2, AA959968, ATP6a1, Atp6n1, Atp6n1a, Atpv0a1, Vpp-1, Vpp1, ATP6V1A, MGC63516, ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Dog (Canine), Xenopus laevis, Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503923
Quantity 50 µg
Price
317.90 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A (ATP6V1A) (N-Term) antibody

Product details

Target Details Application Details Handling Images References Alternatives back to top
Immunogen The immunogen for anti-ATP6V1A antibody: synthetic peptide directed towards the N terminal of human ATP6V1A
Sequence SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDIS SQTQSIYIPR
Predicted Reactivity 156577
Characteristics This is a rabbit polyclonal antibody against ATP6V1A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified

Target Details

Application Details Handling Images References Alternatives back to top
Alternative Name ATP6V1A
Background This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sort
Molecular Weight 68kDa
Gene ID 523
NCBI Accession NP_001681, NM_001690
UniProt P38606
Research Area Signaling, Metabolism

Application Details

Target Details Handling Images References Alternatives back to top
Restrictions For Research Use only

Handling

Target Details Application Details Images References Alternatives back to top
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ATP6V1A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20°C.

References

Target Details Application Details Handling Images Alternatives back to top
Background publications Lu, Ammar, Ives et al.: "Physical interaction between aldolase and vacuolar H+-ATPase is essential for the assembly and activity of the proton pump." in: The Journal of biological chemistry, Vol. 282, Issue 34, pp. 24495-503, 2007 (PubMed).

Alternatives

Target Details Application Details Handling Images References back to top
Alternatives for antigen "ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A (ATP6V1A)", type "Antibodies"
Hosts (26), (2)
Reactivities (27), (20), (19), (17), (17), (17), (17), (17), (17), (2), (2), (2), (2), (2), (2)
Applications (15), (13), (8), (6), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (17), (1), (1), (1), (1)
Beacon
Guglhupf
Guglhupf Guglhupf Guglhupf