ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A (ATP6V1A) (N-Term) antibody

Details for Product No. ABIN503923
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
AA959968, ATP6a1, Atp6n1, Atp6n1a, Atpv0a1, Vpp-1, Vpp1, HO68, VA68, VPP2, Vma1, ATP6A1, ATP6V1A1, Atp6a1, Atp6a2, AI647066, Atp6v1a1, atp6a1, atp6v1a1, ho68, v1a, va68, vma1, vpp2, ATP6V1A, atp6v1al, ... show more
AA959968, ATP6a1, Atp6n1, Atp6n1a, Atpv0a1, Vpp-1, Vpp1, HO68, VA68, VPP2, Vma1, ATP6A1, ATP6V1A1, Atp6a1, Atp6a2, AI647066, Atp6v1a1, atp6a1, atp6v1a1, ho68, v1a, va68, vma1, vpp2, ATP6V1A, atp6v1al, zgc:63516, An02g10440, AO090102000349 show less
Epitope
N-Term
(2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Dog (Canine), Xenopus laevis, Fruit Fly (Drosophila melanogaster), Human, Chicken
(29), (18), (15), (14), (12), (12), (2), (2), (2), (2), (2), (2)
Host
Rabbit
(26), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (13), (10), (9), (5), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN503923
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ATP6V1A
Sequence SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDIS SQTQSIYIPR
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against ATP6V1A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ATP6V1A
Background This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sort
Molecular Weight 68 kDa
Gene ID 523
NCBI Accession NM_001690, NP_001681
UniProt P38606
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 617 AA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A (ATP6V1A) (N-Term) antibody WB Suggested Anti-ATP6V1A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain
Background publications Lu, Ammar, Ives et al.: "Physical interaction between aldolase and vacuolar H+-ATPase is essential for the assembly and activity of the proton pump." in: The Journal of biological chemistry, Vol. 282, Issue 34, pp. 24495-503, 2007 (PubMed).

Hosts (26), (5)
Reactivities (29), (18), (15), (14), (12), (12), (2), (2), (2), (2), (2), (2)
Applications (21), (13), (10), (9), (5), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (1), (1), (1)
back to top