Did you know that you can buy products from over 140 different suppliers from us?

ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2) (Middle Region) antibody

Details for Product No. ABIN503926
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Atp6b1b2, Atp6b2, Vatb, vha55, VATB, ATP6B1B2, ATP6B2, HO57, VPP3, Vma2, atp6v1bb, fj51e01, vatB2, wu:fj51e01, zgc:109771, AI194269, AI790362, R74844
Epitope
Middle Region
(4), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
(31), (19), (18), (15), (15), (13), (12), (2), (1), (1)
Host
Rabbit
(26), (8)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (12), (10), (7), (5), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503926
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ATP6V1B2
Sequence NFIAQGPYENRTVFETLDIGWQLLRIFPKEMLKRIPQSTL SEFYPRDSAK
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Zebrafish : 90 %, African clawed frog : 80 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against ATP6V1B2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ATP6V1B2
Background ATP6V1B2 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. ATP6V1B2 is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A, three B, and two G subunits, as well as a C, D, E, F, and H subunit. The V1 domain contains the ATP catalytic site. The protein encoded by this gene is one of two V1 domain B subunit isoforms and is the only B isoform highly expressed in osteoclasts.
Molecular Weight 56 kDa
Gene ID 526
NCBI Accession NM_001693, NP_001684
UniProt P21281
Research Area Neurology, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 511 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2) (Middle Region) antibody WB Suggested Anti-ATP6V1B2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
anti-ATPase, H+ Transporting, Lysosomal 56/58kDa, V1 Subunit B2 (ATP6V1B2) (Middle Region) antibody (2) WB Suggested Anti-ATP6V1B2 Antibody
Positive Control: Lane 1:841 µg mouse brain extract
Primary Antibody Dilution: 1:000
Secondary Antibody: IRDye 800 CW goat anti-rabbit from Li-COR BioscienceSecondry
Antibody Dilution: 1:00,000
Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science
Background publications Chi, Valencia, Hu et al.: "Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes." in: Journal of proteome research, Vol. 5, Issue 11, pp. 3135-44, 2006 (PubMed).

Validation Images
back to top