Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2) antibody

Antigen

Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2)
Synonyms MGC61468, MGC93432, AW049591, BB124140, 5730553K21Rik, prkab2, MGC64365, PRKAB2, DKFZp469M1118
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504035
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name AMPK beta-2 chain / PRKAB2
Gene ID PRKAB2
UniProt O43741
Immunogen The immunogen for anti-PRKAB2 antibody: synthetic peptide directed towards the middle region of human PRKAB2
Sequence RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILN KDTNISCDPA
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PRKAB2 antibody concentration is 1 mg/ml.
Description The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme tha
Characteristics Antigen Size: 272 amino acids
Molecular Weight 30kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-PRKAB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2)", type "Antibodies"
Hosts Rabbit (28), Goat (2), Mouse (1)
Reactivities Human (29), Rat (Rattus) (23), Mouse (Murine) (22), Chicken (19), Cow (Bovine) (19), Dog (Canine) (19), Horse (Equine) (19)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (12), ELISA (9), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (7), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Dot Blot (DB) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (4), Internal Region (1)