Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504069

Chromosome 22 Open Reading Frame 28 (C22orf28) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C22orf28, DJ149A16.6, FAAP, RP1-149A16.6, HSPC117, C1H22orf28, c22orf28, C10H22orf28, MGC154502
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504069
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C22orf28 antibody: synthetic peptide directed towards the N terminal of human C22orf28
Sequence PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQA MFDHIPVGVG
Predicted Reactivity African clawed frog : 100%, Chicken : 100%, Human : 100%, Pig : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against C22orf28. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C22orf28
Background The function of this protein remains unknown.
Molecular Weight 55kDa
Gene ID 51493
NCBI Accession NP_055121, NM_014306
UniProt Q9Y3I0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C22orf28 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Guo, Han, Adam et al.: "Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress." in: Biochemical and biophysical research communications, Vol. 337, Issue 4, pp. 1308-18, 2005 (PubMed).

Alternatives for antigen "Chromosome 22 Open Reading Frame 28 (C22orf28)", type "Antibodies"
Hosts (20), (4)
Reactivities (22), (13), (13), (12), (12)
Applications (15), (12), (10), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (2), (1), (1), (1)
Beacon