Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Chromosome 22 Open Reading Frame 28 (C22orf28) antibody

Antigen

Chromosome 22 Open Reading Frame 28 (C22orf28)

Synonyms HSPC117, DJ149A16.6, RP1-149A16.6, MGC97634, C10H22orf28, MGC154502
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504069
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name C22orf28
Gene ID C22orf28
UniProt Q9Y3I0
Immunogen The immunogen for anti-C22orf28 antibody: synthetic peptide directed towards the N terminal of human C22orf28
Sequence PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQA MFDHIPVGVG
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-C22orf28 antibody concentration is 1 mg/ml.
Description The function of this protein remains unknown.
Characteristics Antigen Size: 505 amino acids
Molecular Weight 55kDa

Application Details

Application Notes WB Suggested Anti-C22orf28 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Guo, Han, Adam et al.: "Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress." in: Biochemical and biophysical research communications, Vol. 337, Issue 4, pp. 1308-18, 2005 (PubMed).

Alternatives

Alternatives for antigen "Chromosome 22 Open Reading Frame 28 (C22orf28)", type "Antibodies"
Hosts Rabbit (29), Goat (4)
Reactivities Human (31), Mouse (Murine) (22), Rat (Rattus) (20), Cow (Bovine) (19), Dog (Canine) (19), Pig (Porcine) (18), Rabbit (18), Cat (Feline) (1), Chicken (1)
Applications Western Blotting (WB) (18), Immunofluorescence (IF) (16), ELISA (15), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes Internal Region (3), Center (2), Internal Region,AA 125-138 (1), Internal Region,AA 201-215 (1), N-Term (1)