Patatin-Like phospholipase Domain Containing 8 (PNPLA8) antibody

Antigen: Patatin-Like phospholipase Domain Containing 8 (PNPLA8)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN504075

Additional Information

Alternative name: PNPLA8

Gene ID: PNPLA8

UniProt: Q9NP80

Immunogen: The immunogen for anti-PNPLA8 antibody: synthetic peptide directed towards the middle region of human PNPLA8

Sequence: IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKG VAVKERIIPY

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PNPLA8 antibody concentration is 1 mg/ml.

Description: Phospholipase A2 catalyzes cleavage of fatty acids from phospholipids, thereby regulating membrane physical properties and the release of lipid second messengers and growth factors. Phospholipase A2 activity also modulates cellular growth programs, inflam

Characteristics: Antigen Size: 782 amino acids

Molecular Weight: 88kDa

Application Details

Application Notes: WB Suggested Anti-PNPLA8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cardiovascular, Fatty Acids, Metabolism

Restrictions: For Research Use only

Images

WB Suggested Anti-PNPLA8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Publications

Product: Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).