Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5) antibody

Antigen: Ubiquitin Carboxyl-terminal Hydrolase L5 (UCHL5)

Synonyms: UCH37, CGI-70, INO80R, Uch37, 5830413B11Rik, UCHL5, MGC127682, zgc:85615, wu:fj17f09, uch37, cgi-70, DKFZp459M0513

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN504089

Additional Information

Alternative name: UCHL5

Gene ID: UCHL5

UniProt: Q9Y5K5

Immunogen: The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the middle region of human UCHL5

Sequence: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRF NLMAIVSDRK

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-UCHL5 antibody concentration is 1 mg/ml.

Description: UCHL5 is the deubiquitinating enzyme associated with the proteasome.

Characteristics: Antigen Size: 329 amino acids

Molecular Weight: 37kDa

Application Details

Application Notes: WB Suggested Anti-UCHL5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Small Intestine.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-UCHL5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Small Intestine

Publications

Product: Qiu, Ouyang, Li et al.: "hRpn13/ADRM1/GP110 is a novel proteasome subunit that binds the deubiquitinating enzyme, UCH37." in: The EMBO journal, Vol. 25, Issue 24, pp. 5742-53, 2006 (PubMed).