Heterochromatin Protein 1, Binding Protein 3 (HP1BP3) antibody

Antigen: Heterochromatin Protein 1, Binding Protein 3 (HP1BP3)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN504113

Additional Information

Alternative name: HP1BP3

Gene ID: HP1BP3

UniProt: Q5SSJ5

Immunogen: The immunogen for anti-HP1BP3 antibody: synthetic peptide directed towards the middle region of human HP1BP3

Sequence: QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTF QLKKSGEKPL

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HP1BP3 antibody concentration is 1 mg/ml.

Description: HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function.

Characteristics: Antigen Size: 553 amino acids

Molecular Weight: 61kDa

Application Details

Application Notes: WB Suggested Anti-HP1BP3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Chromatin Binding Proteins

Restrictions: For Research Use only

Images

WB Suggested Anti-HP1BP3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain

Publications

Product: Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).