Chromosome X Open Reading Frame 26 (CXorf26) antibody

Antigen: Chromosome X Open Reading Frame 26 (CXorf26)

Synonyms: MGC874, MGC86379, CXHXorf26

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN504127

Additional Information

Alternative name: CXorf26

Gene ID: CXorf26

UniProt: Q9BVG4

Immunogen: The immunogen for anti-CXorf26 antibody: synthetic peptide directed towards the middle region of human CXorf26

Sequence: KFNGIVEDFNYGTLLRLDCSQGYTEENTIFAPRIQFFAIE IARNREGYNK

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CXorf26 antibody concentration is 1 mg/ml.

Description: The function of this protein remains unknown.

Characteristics: Antigen Size: 233 amino acids

Molecular Weight: 26kDa

Application Details

Application Notes: WB Suggested Anti-CXorf26 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CXorf26 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart

Publications

Product: Cheng, Kapranov, Drenkow et al.: "Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution." in: Science (New York, N.Y.), Vol. 308, Issue 5725, pp. 1149-54, 2005 (PubMed).