Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504130

RAS-Like, Family 12 (RASL12) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RIS, 4631404I11Rik
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504130
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RASL12 antibody: synthetic peptide directed towards the N terminal of human RASL12
Sequence MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKF LTKRFISEYD
Predicted Reactivity Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against RASL12. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RASL12
Background The function of this protein remains unknown.
Molecular Weight 30kDa
Gene ID 51285
NCBI Accession NP_057647, NM_016563
UniProt Q9NYN1
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RASL12 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).

Alternatives for antigen "RAS-Like, Family 12 (RASL12)", type "Antibodies"
Hosts (8), (4)
Reactivities (10), (2)
Applications (10), (3), (2), (1)
Epitopes (4), (3), (3), (2), (1)
Beacon