RAS-Like, Family 12 (RASL12) (N-Term) antibody

Details for Product No. ABIN504130
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms RIS, 4631404I11Rik
Epitope
N-Term
(4), (3), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(9), (2)
Host
Rabbit
(6), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (4), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN504130
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RASL12
Sequence MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKSALTVKF LTKRFISEYD
Predicted Reactivity Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against RASL12. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RASL12
Background The function of this protein remains unknown.
Molecular Weight 30 kDa
Gene ID 51285
NCBI Accession NM_016563, NP_057647
UniProt Q9NYN1
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 266 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RAS-Like, Family 12 (RASL12) (N-Term) antibody WB Suggested Anti-RASL12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate
Background publications Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).

Hosts (6), (5)
Reactivities (9), (2)
Applications (9), (4), (1), (1)
Epitopes (4), (3), (1)
back to top