Did you know that you can buy products from over 140 different suppliers from us?

Chromosome 2 Open Reading Frame 29 (C2orf29) (Middle Region) antibody

Details for Product No. ABIN504139
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C2orf29, c2orf29
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(13), (12), (12)
Host
Rabbit
(15)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (9), (6), (3), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN504139
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C2orf29
Sequence SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNS GFDSSVASQI
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Pig : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against C2orf29. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C2orf29
Background The function of this protein remains unknown.
Molecular Weight 55 kDa
Gene ID 55571
NCBI Accession NM_017546, NP_060016
UniProt Q9UKZ1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 510 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 2 Open Reading Frame 29 (C2orf29) (Middle Region) antibody WB Suggested Anti-C2orf29 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504139
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top