Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504139

Chromosome 2 Open Reading Frame 29 (C2orf29) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C2orf29, c2orf29
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504139
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C2orf29 antibody: synthetic peptide directed towards the middle region of human C2orf29
Sequence SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNS GFDSSVASQI
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Pig : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against C2orf29. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C2orf29
Background The function of this protein remains unknown.
Molecular Weight 55kDa
Gene ID 55571
NCBI Accession NP_060016, NM_017546
UniProt Q9UKZ1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C2orf29 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "Chromosome 2 Open Reading Frame 29 (C2orf29)", type "Antibodies"
Hosts (17)
Reactivities (15), (12), (12)
Applications (10), (8), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1)
Beacon