Leucine Rich Repeat Containing 49 (LRRC49) (N-Term) antibody

Details for Product No. ABIN504150
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI430817, AW050057, D430025H09Rik, PGs4, p79, RGD1309466
Epitope
N-Term
(1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(2)
Host
Rabbit
(3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3)
Pubmed 2 references available
Catalog no. ABIN504150
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human LRRC49
Sequence KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSS LSSFPILQRS
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against LRRC49. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LRRC49
Background The function of this protein remains unknown.
Molecular Weight 79 kDa
Gene ID 54839
NCBI Accession NM_017691, NP_060161
UniProt Q8IUZ0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 686 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Leucine Rich Repeat Containing 49 (LRRC49) (N-Term) antibody WB Suggested Anti-LRRC49 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Hosts (3)
Reactivities (2)
Applications (3)
Epitopes (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top