Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

WD Repeat Domain, phosphoinositide Interacting 1 (WIPI1) antibody

Antigen

WD Repeat Domain, phosphoinositide Interacting 1 (WIPI1)
Synonyms AW411817, MGC36416, D11Ertd498e, 4930533H01Rik, ATG18, WIPI49, FLJ10055, RGD1307754, MGC64205, zgc:64205, WIPI1, atg18, wipi49, MGC145296, WIPI2, MGC128834, MGC159964
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504170
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-WD Repeat Domain, phosphoinositide Interacting 1 (WIPI1) antibody

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name WIPI-1
Gene ID WIPI1
UniProt Q5MNZ9
Immunogen The immunogen for anti-WIPI1 antibody: synthetic peptide directed towards the middle region of human WIPI1
Sequence LLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPG YSEDGGALRG
Cross-Reactivity Human, Mouse (Murine)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-WIPI1 antibody concentration is 1 mg/ml.
Description WD40 repeat proteins are key components of many essential biologic functions. They regulate the assembly of multiprotein complexes by presenting a beta-propeller platform for simultaneous and reversible protein-protein interactions. Members of the WIPI su
Characteristics Antigen Size: 446 amino acids
Molecular Weight 49kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-WIPI1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Proikas-Cezanne, Ruckerbauer, Stierhof et al.: "Human WIPI-1 puncta-formation: a novel assay to assess mammalian autophagy." in: FEBS letters, Vol. 581, Issue 18, pp. 3396-404, 2007 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "WD Repeat Domain, phosphoinositide Interacting 1 (WIPI1)", type "Antibodies"
Hosts Rabbit (29), Mouse (1)
Reactivities Human (28), Mouse (Murine) (23), Rat (Rattus) (23), Pig (Porcine) (19)
Applications Immunofluorescence (IF) (19), Western Blotting (WB) (14), ELISA (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (3), Internal Region (1), N-Term (1)