Melanoma Antigen Family B, 1 (MAGEB1) (Middle Region) antibody

Details for Product No. ABIN504347
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CT3.1, DAM10, MAGE-Xp, MAGEL1, Mageb1, RGD1560904, Mage-b1, Mage-rs1, Magel1, Smage1, dam1, MAGEB1, MAGEB4
Epitope
Middle Region
(3), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(33)
Host
Rabbit
(23), (12)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (11), (10), (10), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN504347
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human MAGEB1
Sequence QEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLA KMNGATPRDF
Predicted Reactivity Human : 100 %, Rabbit : 80 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against MAGEB1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MAGEB1
Background This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68 % sequence identity to each other. The promoters and first exons of the MAGEB gen
Molecular Weight 39 kDa
Gene ID 4112
NCBI Accession NM_177415, NP_803134
UniProt P43366
Research Area Cancer
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 347 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Melanoma Antigen Family B, 1 (MAGEB1) (Middle Region) antibody WB Suggested Anti-MAGEB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome...." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Hosts (23), (12)
Reactivities (33)
Applications (18), (11), (10), (10), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1)
back to top