Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Melanoma Antigen Family B, 1 (MAGEB1) antibody

Antigen

Melanoma Antigen Family B, 1 (MAGEB1)

Synonyms CT3.1, DAM10, MAGEL1, MAGE-Xp, MGC9322, RGD1560904, MAGEB1, MAGEB4
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504347
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name MAGE-B1
Gene ID MAGEB1
UniProt P43366
Immunogen The immunogen for anti-MAGEB1 antibody: synthetic peptide directed towards the middle region of human MAGEB1
Sequence QEKYLKYEQVPNSDPPRYQFLWGPRAYAETTKMKVLEFLA KMNGATPRDF
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-MAGEB1 antibody concentration is 1 mg/ml.
Description This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB gen
Characteristics Antigen Size: 347 amino acids
Molecular Weight 39kDa

Application Details

Application Notes WB Suggested Anti-MAGEB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human brain.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives

Alternatives for antigen "Melanoma Antigen Family B, 1 (MAGEB1)", type "Antibodies"
Hosts Rabbit (29)
Reactivities Human (27)
Applications Immunofluorescence (IF) (15), ELISA (9), Western Blotting (WB) (7), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (IHC) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (3), AA 139-154 (1), Center (1)