Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504348

Melanoma Antigen Family B, 1 (MAGEB1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CT3.1, DAM10, MAGE-Xp, MAGEL1, Mageb1, RGD1560904, Mage-b1, Mage-rs1, Magel1, Smage1, dam1, MAGEB1, MAGEB4
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504348
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MAGEB1 antibody: synthetic peptide directed towards the middle region of human MAGEB1
Sequence EFLAKMNGATPRDFPSHYEEALRDEEERAQVRSSVRARRR TTATTFRARS
Predicted Reactivity Horse : 100%, Human : 100%, Rabbit : 100%, Bovine : 92%, Dog : 85%, Mouse : 85%, Pig : 84%
Characteristics This is a rabbit polyclonal antibody against MAGEB1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MAGEB1
Background This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB gen
Molecular Weight 39kDa
Gene ID 4112
NCBI Accession NP_803134, NM_177415
UniProt P43366
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MAGEB1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "Melanoma Antigen Family B, 1 (MAGEB1)", type "Antibodies"
Hosts (24), (12)
Reactivities (34), (1), (1), (1), (1)
Applications (19), (12), (10), (10), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (3), (2), (1), (1)
Beacon