Ret Finger Protein-Like 3 (RFPL3) antibody

Antigen: Ret Finger Protein-Like 3 (RFPL3)

Synonyms: RFPL3

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN504383

Additional Information

Alternative name: RFPL3

Gene ID: RFPL3

UniProt: O75679

Immunogen: The immunogen for anti-RFPL3 antibody: synthetic peptide directed towards the middle region of human RFPL3

Sequence: VYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGT TDAPVRPGEA

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RFPL3 antibody concentration is 1 mg/ml.

Description: The function remains unknown.

Characteristics: Antigen Size: 317 amino acids

Molecular Weight: 35kDa

Application Details

Application Notes: WB Suggested Anti-RFPL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: COLO205 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RFPL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: COLO205 cell lysate

Publications

Product: Rauch, Li, Wu et al.: "MIRA-assisted microarray analysis, a new technology for the determination of DNA methylation patterns, identifies frequent methylation of homeodomain-containing genes in lung cancer cells." in: Cancer research, Vol. 66, Issue 16, pp. 7939-47, 2006 (PubMed).