Zinc Finger Protein 257 (ZNF257) (N-Term) antibody

Details for Product No. ABIN504388
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms BMZF4, BMZF-4
Epitope
N-Term
(2), (2), (1)
Reactivity
Human
(6)
Host
Rabbit
(4), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN504388
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF257
Sequence PPVMCSHIAEDLCPERDIKYFFQKVILRRYDKCEHENLQL RKGCKSVDEC
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF257. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF257
Background The function of ZNF257 has not yet been determined.
Molecular Weight 66 kDa
Gene ID 113835
NCBI Accession NM_033468, NP_258429
UniProt Q9Y2Q1
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 563 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 257 (ZNF257) (N-Term) antibody WB Suggested Anti-ZNF257 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Han, Zhang, Ye et al.: "Molecular cloning of six novel Krüppel-like zinc finger genes from hematopoietic cells and identification of a novel transregulatory domain KRNB." in: The Journal of biological chemistry, Vol. 274, Issue 50, pp. 35741-8, 2000 (PubMed).

Hosts (4), (2)
Reactivities (6)
Applications (6), (2), (2), (1)
Epitopes (2), (2), (1)
back to top