Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504388

Zinc Finger Protein 257 (ZNF257) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BMZF4, BMZF-4
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504388
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF257 antibody: synthetic peptide directed towards the N terminal of human ZNF257
Sequence PPVMCSHIAEDLCPERDIKYFFQKVILRRYDKCEHENLQL RKGCKSVDEC
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against ZNF257. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF257
Background The function of ZNF257 has not yet been determined.
Molecular Weight 66kDa
Gene ID 113835
NCBI Accession NP_258429, NM_033468
UniProt Q9Y2Q1
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF257 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Han, Zhang, Ye et al.: "Molecular cloning of six novel Krüppel-like zinc finger genes from hematopoietic cells and identification of a novel transregulatory domain KRNB." in: The Journal of biological chemistry, Vol. 274, Issue 50, pp. 35741-8, 2000 (PubMed).

Alternatives for antigen "Zinc Finger Protein 257 (ZNF257)", type "Antibodies"
Hosts (3), (2)
Reactivities (5)
Applications (5), (2), (2), (1)
Epitopes (2), (2), (1)
Beacon