Zinc Finger Protein 257 (ZNF257) antibody

Antigen: Zinc Finger Protein 257 (ZNF257)

Synonyms: BMZF4, BMZF-4

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN504388

Additional Information

Alternative name: ZNF257

Gene ID: ZNF257

UniProt: Q9Y2Q1

Immunogen: The immunogen for anti-ZNF257 antibody: synthetic peptide directed towards the N terminal of human ZNF257

Sequence: PPVMCSHIAEDLCPERDIKYFFQKVILRRYDKCEHENLQL RKGCKSVDEC

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF257 antibody concentration is 1 mg/ml.

Description: The function of ZNF257 has not yet been determined.

Characteristics: Antigen Size: 563 amino acids

Molecular Weight: 66kDa

Application Details

Application Notes: WB Suggested Anti-ZNF257 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF257 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Publications

Product: Han, Zhang, Ye et al.: "Molecular cloning of six novel Krüppel-like zinc finger genes from hematopoietic cells and identification of a novel transregulatory domain KRNB." in: The Journal of biological chemistry, Vol. 274, Issue 50, pp. 35741-8, 2000 (PubMed).