Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Vestigial Like 1 (Drosophila) (VGLL1) antibody

Antigen

Vestigial Like 1 (Drosophila) (VGLL1)

Synonyms TDU, VGL1, RGD1564038, VGLL1, vgl1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504406
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name VGLL1 / TONDU
Gene ID VGLL1
UniProt Q99990
Immunogen The immunogen for anti-VGLL1 antibody: synthetic peptide directed towards the middle region of human VGLL1
Sequence RPQESAARENGNPGQIAGSTGLLFNLPPGSVHYKKLYVSR GSASTSLPNE
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-VGLL1 antibody concentration is 1 mg/ml.
Description VGLL1 is a specific coactivator for the mammalian TEFs. The mammalian TEF and the Drosophila scalloped genes belong to a conserved family of transcriptional factors that possesses a TEA/ATTS DNA-binding domain. In Drosophila, Scalloped (Sd) interacts with Vestigial (Vg) to form a complex, which binds DNA through the Sd TEA/ATTS domain. The Sd-Vg heterodimer is a key regulator of wing development, which directly controls several target genes and is able to induce wing outgrowth when ectopically expressed.
Characteristics Antigen Size: 258 amino acids
Molecular Weight 29kDa

Application Details

Application Notes WB Suggested Anti-VGLL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives

Alternatives for antigen "Vestigial Like 1 (Drosophila) (VGLL1)", type "Antibodies"
Hosts Rabbit (26), Mouse (1)
Reactivities Human (27), Mouse (Murine) (20), Rat (Rattus) (20), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (12), ELISA (9), Immunohistochemistry (IHC) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes Internal Region (1), N-Term (1)