Glutathione Peroxidase 4 (GPX4) antibody

Antigen: Glutathione Peroxidase 4 (GPX4)

Synonyms: MCSP, PHGPx, snGPx, snPHGPx, Phgpx, gpx-4, snGpx, cb563, cb691, PHGPxa, sb:cb563, zgc:92253, wu:fb82e03, mtPHGPx, MGC103187, MGC118087, 1700027O09Rik, F11L15.5, GLUTATHIONE PEROXIDASE 4

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN504477

Additional Information

Gene ID: GPX4

UniProt: P36969

Immunogen: The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4

Sequence: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPG SNEEIKEFAA

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-GPX4 antibody concentration is 1 mg/ml.

Description: Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.Glutathione peroxidase catalyzes the reduction of hydrogen peroxide, organic hydroperoxide, and lipid peroxides by reduced glutathione and functions in the protection of cells against oxidative damage. Human plasma glutathione peroxidase has been shown to be a selenium-containing enzyme and the UGA codon is translated into a selenocysteine. Through alternative splicing and transcription initiation, rat produces proteins that localize to the nucleus, mitochondrion, and cytoplasm. In humans, experimental evidence for alternative splicing exists, alternative transcription initiation and the cleavage sites of the mitochondrial and nuclear transit peptides need to be experimentally verified.

Characteristics: Antigen Size: 197 amino acids

Molecular Weight: 22kDa

Application Details

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

anti-Glutathione Peroxidase 4 (GPX4) antibody

anti-Glutathione Peroxidase 4 (GPX4) antibody (Image 2)

anti-Glutathione Peroxidase 4 (GPX4) antibody (Image 3)

Publications

Product: Peters, Chatterjee, Hayes et al.: "Variation in the selenoenzyme genes and risk of advanced distal colorectal adenoma." in: Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology, Vol. 17, Issue 5, pp. 1144-54, 2008 (PubMed).