Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

RAN Binding Protein 3 (RANBP3) antibody

Antigen

RAN Binding Protein 3 (RANBP3)
Synonyms DKFZp586I1520, AA408221, 2610024N24Rik, ranbp3, MGC79798, RANBP3, DKFZp459E0714
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504487
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-RAN Binding Protein 3 (RANBP3) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name RANBP3
Gene ID RANBP3
UniProt Q9H6Z4
Immunogen The immunogen for anti-RANBP3 antibody: synthetic peptide directed towards the N terminal of human RANBP3
Sequence MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEE PRGEAEAPHH
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-RANBP3 antibody concentration is 1 mg/ml.
Description RANBP3 is a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex.This gene encodes a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Characteristics Antigen Size: 567 amino acids
Molecular Weight 62kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-RANBP3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Yoon, Shin, Liu et al.: "Ran-binding protein 3 phosphorylation links the Ras and PI3-kinase pathways to nucleocytoplasmic transport." in: Molecular cell, Vol. 29, Issue 3, pp. 362-75, 2008 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "RAN Binding Protein 3 (RANBP3)", type "Antibodies"
Hosts Rabbit (30), Mouse (1)
Reactivities Human (29), Mouse (Murine) (22), Rat (Rattus) (20), Cow (Bovine) (1)
Applications Immunofluorescence (IF) (17), Flow Cytometry (FACS) (16), Western Blotting (WB) (14), ELISA (9), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunocytochemistry (ICC) (2), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes AA 1-13 (1), N-Term (1)