RanBP3 antibody (N-Term)
-
- Target See all RanBP3 (RANBP3) Antibodies
- RanBP3 (RANBP3) (RAN Binding Protein 3 (RANBP3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RanBP3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RanBP3 antibody was raised against the N terminal of RANBP3
- Purification
- Affinity purified
- Immunogen
- RanBP3 antibody was raised using the N terminal of RANBP3 corresponding to a region with amino acids MADLANEEKPAIAPPVFVFQKDKGQKSPAEQKNLSDSGEEPRGEAEAPHH
- Top Product
- Discover our top product RANBP3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RanBP3 Blocking Peptide, catalog no. 33R-5623, is also available for use as a blocking control in assays to test for specificity of this RanBP3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RANBP3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RanBP3 (RANBP3) (RAN Binding Protein 3 (RANBP3))
- Alternative Name
- RanBP3 (RANBP3 Products)
- Synonyms
- 2610024N24Rik antibody, AA408221 antibody, ranbp3 antibody, MGC79798 antibody, zgc:63485 antibody, RAN binding protein 3 antibody, RAN binding protein 3 L homeolog antibody, RAN binding protein 3a antibody, RANBP3 antibody, Ranbp3 antibody, ranbp3.L antibody, ranbp3 antibody, ranbp3a antibody
- Background
- RANBP3 is a protein with a RanBD1 domain that is found in both the nucleus and cytoplasm. This protein plays a role in nuclear export as part of a heteromeric complex.
- Molecular Weight
- 62 kDa (MW of target protein)
-