Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) antibody
| Antigen | Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH) |
| Synonyms |
G3PD, GAPD, MGC88685, Gapd, MGC102544, MGC102546, MGC103190, MGC103191, MGC105239, GA3PDH, GADPH, GAP, GAPDH, GAPDH II, GAPDH2, Gapdh-2, Gapdh13F, DmelCG8893, CG8893, BEST:GH12586, GAPDH I, GAPDH-1, G ...
show more
|
| Clonality | Polyclonal |
| Host |
Alternatives Rabbit |
| Reactivity |
Alternatives Human |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB) |
![]() |
1 reference available |
| Catalog no. | ABIN504497 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | GAPDH |
| Gene ID | GAPDH |
| UniProt | P04406 |
| Immunogen | The immunogen for anti-GAPDH antibody: synthetic peptide directed towards the middle region of human GAPDH |
| Sequence | KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKI ISNASCTTNC |
| Cross-Reactivity | Human |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-GAPDH antibody concentration is 1 mg/ml. |
| Description | GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a |
| Characteristics | Antigen Size: 335 amino acids |
| Molecular Weight | 36kDa |
| Synonyms | G3PD, GAPD, MGC88685, Gapd, MGC102544, MGC102546, MGC103190, MGC103191, MGC105239, GA3PDH, GADPH, GAP, GAPDH, GAPDH II, GAPDH2, Gapdh-2, Gapdh13F, DmelCG8893, CG8893, BEST:GH12586, GAPDH I, GAPDH-1, Gapdh43E, gh12586, DmelCG12055, CG12055, MGC127711, gapd, cb609, wu:fb33a10, KNC-NDS6, g3pd, MGC89215, G3PDH, DKFZp468E2417, MGC53986, GAPC-2, GAPC2, GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE C-2, glyceraldehyde-3-phosphate dehydrogenase C2, T6J4.17, T6J4_17 |
Application Details
| Application Notes |
WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: NCI-H226 cell lysate. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Research Area | Cancer, Metabolism, Alzheimer's Disease, Enzymes |
| Restrictions | For Research Use only |
Images
|
WB Suggested Anti-GAPDH Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: NCI-H226 cell lysate |
Publications
| Product |
Rinne, Clements, Lamme et al.: "A novel translation re-initiation mechanism for the p63 gene revealed by amino-terminal truncating mutations in Rapp-Hodgkin/Hay-Wells-like syndromes." in: Human molecular genetics, Vol. 17, Issue 13, pp. 1968-77, 2008 (PubMed).
|
Alternatives
Alternatives for antigen "Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH)", type "Antibodies"




Alternatives