ATPase, H+ Transporting, Lysosomal 31kDa, V1 Subunit E2 (ATP6V1E2) (Middle Region) antibody

Details for Product No. ABIN504500
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
Middle Region
(3), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(9), (4), (2)
Host
Rabbit
(10), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (3), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN504500
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ATP6V1E2
Sequence LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPE VYQGLLDKLV
Predicted Reactivity Asian toad :85 %,   American bullfrog :85 %,   Chicken :85 %,   Rainbow smelt :85 %,   Rat :75 %,   Sheep :75 %,   Crab-eating macaque :75 %,   Mouse :75 %,   Bovine :75 %,   Dog :75 %,   Leschenault's rousette :75 %,   Indian short-nosed fruit bat :75 %,   Schreibers's long-fingered bat :75 %,   Lesser asiatic yellow bat :75 %,   Zebra finch :75 %,   Human :105 %,   Atlantic salmon :75 %,   Sablefish :75 %,   Green puffer :75 %,  
Characteristics This is a rabbit polyclonal antibody against ATP6V1E2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ATP6V1E2
Background ATP6V1E2 is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome.
Molecular Weight 26 kDa
Gene ID 90423
NCBI Accession NM_080653, NP_542384
UniProt Q96A05
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 226 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ATPase, H+ Transporting, Lysosomal 31kDa, V1 Subunit E2 (ATP6V1E2) (Middle Region) antibody WB Suggested Anti-ATP6V1E2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Spleen
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4...." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Hosts (10), (2)
Reactivities (9), (4), (2)
Applications (11), (3), (3), (3), (1)
Epitopes (3), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top