Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504500

ATPase, H+ Transporting, Lysosomal 31kDa, V1 Subunit E2 (ATP6V1E2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504500
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ATP6V1E2 antibody: synthetic peptide directed towards the middle region of human ATP6V1E2
Sequence LMSTMRNQARLKVLRARNDLISDLLSEAKLRLSRIVEDPE VYQGLLDKLV
Predicted Reactivity Asian toad :85%,   American bullfrog :85%,   Chicken :85%,   Rainbow smelt :83%,   Rat :78%,   Sheep :78%,   Crab-eating macaque :78%,   Mouse :78%,   Bovine :78%,   Dog :78%,   Leschenault's rousette :78%,   Indian short-nosed fruit bat :78%,   Schreibers's long-fingered bat :78%,   Lesser asiatic yellow bat :78%,   Zebra finch :78%,   Human :100%,   Atlantic salmon :76%,   Sablefish :76%,   Green puffer :75%,  
Characteristics This is a rabbit polyclonal antibody against ATP6V1E2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ATP6V1E2
Background ATP6V1E2 is a subunit of the peripheral V1 complex of vacuolar ATPase essential for assembly or catalytic function. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells. This isoform is essential for energy coupling involved in acidification of acrosome.
Molecular Weight 26kDa
Gene ID 90423
NCBI Accession NP_542384, NM_080653
UniProt Q96A05
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ATP6V1E2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "ATPase, H+ Transporting, Lysosomal 31kDa, V1 Subunit E2 (ATP6V1E2)", type "Antibodies"
Hosts (7), (2)
Reactivities (6), (4), (2)
Applications (8), (3), (2), (1), (1)
Epitopes (3), (2), (1)
Beacon