Thrombopoietin (THPO) antibody

Antigen: Thrombopoietin (THPO)

Synonyms: ML, TPO, MGDF, MKCSF, MPLLG, MGC163194, Ml, Tpo, Mgdf, Tpo1, Tpo2, Tpo3, Tpo4, Mpllg, THPO, tpo, LOC100231762

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN504524

Additional Information

Alternative name: Thrombopoietin

Gene ID: THPO

UniProt: P40225

Immunogen: The immunogen for anti-THPO antibody: synthetic peptide directed towards the middle region of human THPO

Sequence: NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPD PSAPTPTPTS

Cross-Reactivity: Dog (Canine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-THPO antibody concentration is 1 mg/ml.

Description: Megakaryocytopoiesis is the cellular development process that leads to platelet production. THPO is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. THPO is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene.Megakaryocytopoiesis is the cellular development process that leads to platelet production. The protein encoded by this gene is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/C_MPL, the product of myeloproliferative leukemia virus oncogene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 353 amino acids

Molecular Weight: 35kDa

Application Details

Application Notes: WB Suggested Anti-THPO Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cancer, Cell Cycle, Hormones

Restrictions: For Research Use only

Images

WB Suggested Anti-THPO Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Publications

Product: Baker, Su, Hsu et al.: "Human thrombopoietin reduces myocardial infarct size, apoptosis, and stunning following ischaemia/reperfusion in rats." in: Cardiovascular research, Vol. 77, Issue 1, pp. 44-53, 2008 (PubMed).

Baker, Gray, Wright et al.: "The effect of a pedometer-based community walking intervention "Walking for Wellbeing in the West" on physical activity levels and health outcomes: a 12-week randomized controlled trial." in: The international journal of behavioral nutrition and physical activity, Vol. 5, pp. 44, 2008 (PubMed).