Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504548

Eukaryotic Translation Initiation Factor 2C3 (EIF2C3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EIF2C3, AW048688, C130014L07Rik, Eif2c3, Argonaute3, ago3, eif2c3, eif2c3b, si:dkey-3n22.3, ARGONAUTE 3, T19E23.8, T19E23_8
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Cow (Bovine), Dog (Canine), Pig (Porcine), Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504548
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EIF2C3 antibody: synthetic peptide directed towards the N terminal of human EIF2C3
Sequence MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCG TMRRKYRVCN
Predicted Reactivity Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against EIF2C3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EIF2C3
Background EIF2C3 is a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing. This gene is
Molecular Weight 69kDa
Gene ID 192669
NCBI Accession NP_803171, NM_177422
UniProt B1ALI0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EIF2C3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Sasaki, Shiohama, Minoshima et al.: "Identification of eight members of the Argonaute family in the human genome small star, filled." in: Genomics, Vol. 82, Issue 3, pp. 323-30, 2003 (PubMed).

Alternatives for antigen "Eukaryotic Translation Initiation Factor 2C3 (EIF2C3)", type "Antibodies"
Hosts (18), (2)
Reactivities (18), (14), (12), (12), (12), (12)
Applications (10), (10), (4), (3), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (1), (1)
Beacon