Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (E2IG3) antibody

Antigen

Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (E2IG3)

Synonyms NS, E2IG3, C77032, MGC800, Ns, BC037996, MGC46970, nstm, MGC123093, id:ibd2914, wu:fb38a04, wu:fc55d07, zgc:123093, gnl3, GNL3
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504554
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Nucleostemin
Gene ID GNL3
UniProt Q9BVP2-2
Immunogen The immunogen for anti-GNL3 antibody: synthetic peptide directed towards the N terminal of human GNL3
Sequence MTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPRKDPGVPN SAPFKEALLR
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-GNL3 antibody concentration is 1 mg/ml.
Description GNL3 may be required to maintain the proliferative capacity of stem cells and may play an important role in tumorigenesis.
Characteristics Antigen Size: 537 amino acids
Molecular Weight 60kDa

Application Details

Application Notes WB Suggested Anti-GNL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Stomach.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Embryogenesis, Embryonic stem cells, Neural Stem Cell marker, Apoptosis/Necrosis
Restrictions For Research Use only

Publications

Product Ma, Pederson: "Depletion of the nucleolar protein nucleostemin causes G1 cell cycle arrest via the p53 pathway." in: Molecular biology of the cell, Vol. 18, Issue 7, pp. 2630-5, 2007 (PubMed).

Alternatives

Alternatives for antigen "Guanine Nucleotide Binding Protein-Like 3 (Nucleolar) (E2IG3)", type "Antibodies"
Hosts Rabbit (38), Chicken (1), Goat (1)
Reactivities Human (38), Mouse (Murine) (19), Rat (Rattus) (19), Chicken (18), Cat (Feline) (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Western Blotting (WB) (23), ELISA (18), Immunofluorescence (IF) (16), Immunohistochemistry (IHC) (5), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoprecipitation (IP) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Flow Cytometry (FACS) (1), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (4), Internal Region (2), Nucleolar (2), AA 1-280 (1), AA 1-50 (1), Center (1), N-Term (1)