Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504555

Jumonji, AT Rich Interactive Domain 2 (JARID2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms JMJ, Jmj, jumonji, JARID2, jarid2, jmj
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504555
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-JARID2 antibody: synthetic peptide directed towards the N terminal of human JARID2
Sequence THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHS DHRADSRREQ
Predicted Reactivity Human : 100%, Rabbit : 92%, Bovine : 85%, Guinea pig : 85%, Pig : 85%, Mouse : 78%
Characteristics This is a rabbit polyclonal antibody against JARID2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name JARID2
Background This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a
Molecular Weight 139kDa
Gene ID 3720
NCBI Accession NP_004964, NM_017566
UniProt Q92833
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-JARID2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Alternatives for antigen "Jumonji, AT Rich Interactive Domain 2 (JARID2)", type "Antibodies"
Hosts (29), (2), (1), (1)
Reactivities (29), (24), (13), (13), (13), (13), (12)
Applications (23), (10), (8), (5), (2), (2), (2)
Conjugates (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (6), (3), (1), (1), (1)
Beacon