Did you know that you can buy products from over 140 different suppliers from us?

Jumonji, AT Rich Interactive Domain 2 (JARID2) (N-Term) antibody

Details for Product No. ABIN504555
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms JARID2, jarid2, jmj, Jmj, jumonji, JMJ
Epitope
N-Term
(9), (7), (3), (2), (1), (1)
Reactivity
Human
(25), (24), (13), (13), (13), (13), (12)
Host
Rabbit
(25), (2), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(20), (10), (4), (3), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504555
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human JARID2
Sequence THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHS DHRADSRREQ
Predicted Reactivity Human : 100 %, Rabbit : 90 %, Bovine : 80 %, Guinea pig : 80 %, Pig : 80 %, Mouse : 70 %
Characteristics This is a rabbit polyclonal antibody against JARID2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name JARID2
Background This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a
Molecular Weight 139 kDa
Gene ID 3720
NCBI Accession NM_017566, NP_004964
UniProt Q92833
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1246 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Jumonji, AT Rich Interactive Domain 2 (JARID2) (N-Term) antibody WB Suggested Anti-JARID2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
anti-Jumonji, AT Rich Interactive Domain 2 (JARID2) (N-Term) antibody (2) Host: Rabbit
Target Name: JARID2
Sample Tissue: 721_B
Antibody Dilution: 1.0 µg/mL JARID2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
anti-Jumonji, AT Rich Interactive Domain 2 (JARID2) (N-Term) antibody (3) WB Suggested Anti-JARID2
Antibody Titration: 0.2-1 µg/mL ELISA Titer: 1:.12500
Positive Control: Hela cell lysate
JARID2 is supported by BioGPS gene expression data to be expressed in HeLa
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Validation Images
back to top