CSE1 Chromosome Segregation 1-Like (Yeast) (CSE1L) antibody

Antigen: CSE1 Chromosome Segregation 1-Like (Yeast) (CSE1L)

Synonyms: CAS, CSE1, XPO2, MGC117283, MGC130036, MGC130037, CSE1L, Exportin-2, DKFZp459E1929

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Xenopus laevis, Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN504561

Additional Information

Alternative name: XPO2 / Exportin-2

Gene ID: CSE1L

UniProt: P55060

Immunogen: The immunogen for anti-CSE1L antibody: synthetic peptide directed towards the N terminal of human CSE1L

Sequence: ELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQN YPLLLLTLLE

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CSE1L antibody concentration is 1 mg/ml.

Description: Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. CSE1L binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the protein may play a role both in apoptosis and in cell proliferation.Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 971 amino acids

Molecular Weight: 110kDa

Application Details

Application Notes: WB Suggested Anti-CSE1L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CSE1L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Publications

Product: Kim, Jiang, Du et al.: "PHAPI, CAS, and Hsp70 promote apoptosome formation by preventing Apaf-1 aggregation and enhancing nucleotide exchange on Apaf-1." in: Molecular cell, Vol. 30, Issue 2, pp. 239-47, 2008 (PubMed).