Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

serine/threonine Kinase 17a (STK17A) antibody

Antigen

serine/threonine Kinase 17a (STK17A)

Synonyms DAP6, EAP1, BING2, MGC126245, MGC126246, MGC150289, DAP-3, 4921514D13Rik, im:6905684, LOC100226911, DRAK1, STK17A, MGC140096
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Rabbit, Chicken

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN504576
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name STK17A / DRAK1
Gene ID STK17A
UniProt Q9UEE5
Immunogen The immunogen for anti-STK17A antibody: synthetic peptide directed towards the C terminal of human STK17A
Sequence KESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFE EPLLQEIPGE
Cross-Reactivity Cow (Bovine), Chicken, Human, Rabbit
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-STK17A antibody concentration is 1 mg/ml.
Description STK17A belongs to the protein kinase superfamily, CAMK Ser/Thr protein kinase family, DAP kinase subfamily. It contains 1 protein kinase domain. STK17A acts as a positive regulator of apoptosis.This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity.
Characteristics Antigen Size: 414 amino acids
Molecular Weight 46kDa

Application Details

Application Notes WB Suggested Anti-STK17A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Sanjo, Kawai, Akira: "DRAKs, novel serine/threonine kinases related to death-associated protein kinase that trigger apoptosis." in: The Journal of biological chemistry, Vol. 273, Issue 44, pp. 29066-71, 1998 (PubMed).

Alternatives

Alternatives for antigen "serine/threonine Kinase 17a (STK17A)", type "Antibodies"
Hosts Rabbit (36), Mouse (5), Goat (2)
Reactivities Human (42), Mouse (Murine) (19), Rat (Rattus) (18)
Applications Western Blotting (WB) (26), Immunofluorescence (IF) (15), ELISA (14), Immunocytochemistry (ICC) (4), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (IHC) (2), Dot Blot (Dot) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (6), C-Term (3), AA 5-19 (2)