Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504581

Receptor-Interacting Serine-threonine Kinase 2 (RIPK2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2210420D18Rik, CARD3, CARDIAK, CCK, D4Bwg0615e, RICK, RIP2, GIG30, RIPK2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504581
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RIPK2 antibody: synthetic peptide directed towards the middle region of human RIPK2
Sequence LRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHT LRKKLILSYT
Predicted Reactivity Bovine : 85%, Dog : 85%, Horse : 85%, Human : 85%, Rabbit : 84%, Chicken : 78%, Guinea pig : 78%, Mouse : 78%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against RIPK2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RIPK2
Background RIPK2 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. It contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli.This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli.
Molecular Weight 61kDa
Gene ID 8767
NCBI Accession NP_003812, NM_003821
UniProt O43353
Research Area Apoptosis/Necrosis, Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RIPK2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hasegawa, Fujimoto, Lucas et al.: "A critical role of RICK/RIP2 polyubiquitination in Nod-induced NF-kappaB activation." in: The EMBO journal, Vol. 27, Issue 2, pp. 373-83, 2008 (PubMed).

Alternatives for antigen "Receptor-Interacting Serine-threonine Kinase 2 (RIPK2)", type "Antibodies"
Hosts (74), (15), (5)
Reactivities (93), (37), (20)
Applications (91), (47), (23), (21), (12), (7), (3), (2), (1), (1), (1), (1)
Epitopes (14), (14), (7), (5), (4), (3), (2), (2), (2)
Beacon