Did you know that you can buy products from over 140 different suppliers from us?

Receptor-Interacting Serine-threonine Kinase 2 (RIPK2) (Middle Region) antibody

Details for Product No. ABIN504581
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2210420D18Rik, CARD3, CARDIAK, CCK, D4Bwg0615e, RICK, RIP2, GIG30, RIPK2
Epitope
Middle Region
(20), (14), (13), (5), (5), (3), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
(108), (41), (21)
Host
Rabbit
(89), (15), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunofluorescence (IF), Western Blotting (WB)
(105), (58), (35), (24), (10), (6), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN504581
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RIPK2
Sequence LRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHT LRKKLILSYT
Predicted Reactivity Bovine : 85 %, Dog : 85 %, Horse : 85 %, Human : 85 %, Rabbit : 85 %, Chicken : 75 %, Guinea pig : 75 %, Mouse : 75 %, Rat : 75 %
Characteristics This is a rabbit polyclonal antibody against RIPK2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RIPK2
Background RIPK2 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. It contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli.This gene encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli.
Molecular Weight 61 kDa
Gene ID 8767
NCBI Accession NM_003821, NP_003812
UniProt O43353
Research Area Apoptosis/Necrosis, Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 540 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Receptor-Interacting Serine-threonine Kinase 2 (RIPK2) (Middle Region) antibody WB Suggested Anti-RIPK2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Hasegawa, Fujimoto, Lucas et al.: "A critical role of RICK/RIP2 polyubiquitination in Nod-induced NF-kappaB activation." in: The EMBO journal, Vol. 27, Issue 2, pp. 373-83, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN504581
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top