Regulator of G-Protein Signaling 11 (RGS11) antibody

Antigen: Regulator of G-Protein Signaling 11 (RGS11)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Chicken, Pig (Porcine), Rabbit

Application: Western Blotting (WB)

Catalog no.: ABIN504607

Additional Information

Alternative name: RGS11

Gene ID: RGS11

UniProt: Q4TT72

Immunogen: The immunogen for anti-RGS11 antibody: synthetic peptide directed towards the middle region of human RGS11

Sequence: LRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAE AGIPLEMKRR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RGS11 antibody concentration is 1 mg/ml.

Description: RGS11 belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form.The protein encoded by this gene belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Characteristics: Antigen Size: 446 amino acids

Molecular Weight: 51kDa

Application Details

Application Notes: WB Suggested Anti-RGS11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Immunology

Restrictions: For Research Use only

Images

WB Suggested Anti-RGS11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 293T cell lysate

Publications

Product: Martin, Han, Gordon et al.: "The sequence and analysis of duplication-rich human chromosome 16." in: Nature, Vol. 432, Issue 7020, pp. 988-94, 2004 (PubMed).