N-Ethylmaleimide-Sensitive Factor Attachment Protein, beta (NAPB) antibody

Antigen: N-Ethylmaleimide-Sensitive Factor Attachment Protein, beta (NAPB)

Synonyms: SNAPB, MGC26066, MGC48335, SNAP-BETA, MGC80463, MGC80636, napb, Snapb, SNAP-beta, MGC137651, snapb, MGC145202, snap-beta, DKFZp459J031

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN504623

Additional Information

Alternative name: SNAP beta

Gene ID: NAPB

UniProt: Q9H115

Immunogen: The immunogen for anti-NAPB antibody: synthetic peptide directed towards the N terminal of human NAPB

Sequence: MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEE ACEMYTRAAN

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NAPB antibody concentration is 1 mg/ml.

Description: NAPB is required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.

Characteristics: Antigen Size: 298 amino acids

Molecular Weight: 33kDa

Application Details

Application Notes: WB Suggested Anti-NAPB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: SH-SYSY cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-NAPB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: SH-SYSY cell lysate

Publications

Product: Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).