Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504634

T-Cell Acute Lymphocytic Leukemia 2 (TAL2) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms bHLHa19, Tail2, zgc:111884
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504634
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TAL2 antibody: synthetic peptide directed towards the middle region of human TAL2
Sequence LGEQSLQQTGVAAQGNILGLFPQGPHLPGLEDRTLLENYQ VPSPGPSHHI
Cross-Reactivity Human
Predicted Reactivity Human : 100%, Bovine : 78%
Characteristics Antigen Size: 108 amino acids
Purification Affinity Purified
Alternative Name TAL2
Background TAL2 is a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia.
Molecular Weight 12kDa
Gene ID TAL2
UniProt Q16559
Research Area Cancer, Transcription Factors
Application Notes WB Suggested Anti-TAL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Spleen.
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µl of distilled water
Buffer Final anti-TAL2 antibody concentration is 1 mg/ml.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -20°C
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Alternatives for antigen "T-Cell Acute Lymphocytic Leukemia 2 (TAL2)", type "Antibodies"
Hosts (7), (2)
Reactivities (6), (4), (1), (1), (1), (1), (1), (1), (1)
Applications (9), (3), (1)
Epitopes (2), (2), (2), (1)
Beacon