ECHS1 antibody (Middle Region)

Catalog No. ABIN629671

This Rabbit Polyclonal antibody specifically detects ECHS1 in WB. It exhibits reactivity toward Human, Mouse, Rat and Dog.

Quick Overview for ECHS1 antibody (Middle Region) (ABIN629671)

Target: ECHS1 (Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ECHS1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ECHS1 Antibody

Binding Specificity: Middle Region

Specificity: ECHS1 antibody was raised against the middle region of ECHS1

Purification: Purified

Immunogen: ECHS1 antibody was raised using the middle region of ECHS1 corresponding to a region with amino acids RAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIA

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ECHS1 Blocking Peptide, (ABIN5613297), is also available for use as a blocking control in assays to test for specificity of this ECHS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ECHS1

Target: ECHS1 (Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1))

Alternative Name: ECHS1

Background: ECHS1 functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. ECHS1 is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process