ECHS1 antibody (C-Term)

Catalog No. ABIN629680

This Rabbit Polyclonal antibody specifically detects ECHS1 in WB. It exhibits reactivity toward Human.

Quick Overview for ECHS1 antibody (C-Term) (ABIN629680)

Target: ECHS1 (Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ECHS1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ECHS1 Antibody

Binding Specificity: C-Term

Specificity: ECHS1 antibody was raised against the C terminal of ECHS1

Purification: Purified

Immunogen: ECHS1 antibody was raised using the C terminal of ECHS1 corresponding to a region with amino acids KESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ECHS1 Blocking Peptide, (ABIN939745), is also available for use as a blocking control in assays to test for specificity of this ECHS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ECHS1

Target: ECHS1 (Enoyl CoA Hydratase, Short Chain, 1, Mitochondrial (ECHS1))

Alternative Name: ECHS1

Background: ECHS1 functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. ECHS1 is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process