NAA50 antibody (C-Term)

Catalog No. ABIN629779

This Rabbit Polyclonal antibody specifically detects NAA50 in WB. It exhibits reactivity toward Human.

Quick Overview for NAA50 antibody (C-Term) (ABIN629779)

Target: NAA50 (N(alpha)-Acetyltransferase 50, NatE Catalytic Subunit (NAA50))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NAA50 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NAA50 Antibody

Binding Specificity: C-Term

Specificity: NAT13 antibody was raised against the C terminal of NAT13

Purification: Purified

Immunogen: NAT13 antibody was raised using the C terminal of NAT13 corresponding to a region with amino acids AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NAT13 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this NAT13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NAA50

Target: NAA50 (N(alpha)-Acetyltransferase 50, NatE Catalytic Subunit (NAA50))

Alternative Name: NAT13

Background: NAT13 is a probable catalytic component of the ARD1A-NARG1 complex which displays alpha (N-terminal) acetyltransferase activity.

Molecular Weight: 19 kDa (MW of target protein)