Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Cystathionase (Cystathionine gamma-Lyase) (CTH) antibody

Antigen

Cystathionase (Cystathionine gamma-Lyase) (CTH)

Synonyms CTH, DKFZp469D0332, zgc:66001, zgc:85785, wu:fb48e03, wu:fb58d08, Cys3, AI314617, BC019483, MGC28655, 0610010I13Rik, MGC9471, cysA, SCQ11.03c, H, MGC75946
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Immunohistochemistry (IHC), Western Blotting (WB)
Catalog no. ABIN629826
Quantity 100 ug  (1 mg/ml)  (Variants)
Price 410.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name Cystathionase
Immunogen Cystathionase antibody was raised using a synthetic peptide corresponding to a region with amino acids ESNPWVEKVIYPGLPSHPQHELVKRQCTGCTGMVTFYIKGTLQHAEIFLK
Description CTH is a cytoplasmic enzyme in the trans-sulfuration pathway that converts cystathione derived from methionine into cysteine. Glutathione synthesis in the liver is dependent upon the availability of cysteine. Mutations in its gene cause cystathioninuria.
Molecular Weight 44 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CTH antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Signaling, Metabolism, Amino Acids
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Cystathionase (Cystathionine gamma-Lyase) (CTH)", type "Antibodies"
Hosts Rabbit (1)
Applications Western Blotting (WB) (1)