VDAC1 antibody (C-Term)

Catalog No. ABIN630114

The Rabbit Polyclonal anti-VDAC1 antibody (ABIN630114) specifically detects VDAC1 in WB and IHC. The antibody is reactive with Human, Rat, Mouse and Dog samples.

Quick Overview for VDAC1 antibody (C-Term) (ABIN630114)

Target: VDAC1 (Voltage-Dependent Anion Channel 1 (VDAC1))

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VDAC1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-VDAC1 Antibody

Binding Specificity: C-Term

Specificity: VDAC1 antibody was raised against the C terminal of VDAC1

Purification: Purified

Immunogen: VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VDAC1 Blocking Peptide, (ABIN5616953), is also available for use as a blocking control in assays to test for specificity of this VDAC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VDAC1

Target: VDAC1 (Voltage-Dependent Anion Channel 1 (VDAC1))

Alternative Name: VDAC1

Background: The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis.

Molecular Weight: 31 kDa (MW of target protein)