Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

3-Hydroxy-3-Methylglutaryl-Coenzyme A Lyase (HMGCL) antibody

Antigen

3-Hydroxy-3-Methylglutaryl-Coenzyme A Lyase (HMGCL)

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN630162
Quantity 100 ug  (1 mg/ml)  (Variants)
Price 410.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name HMGCL
Immunogen HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA
Description The deficiency of HMGCL is related to an autosomal recessive branched chain organic aciduria.
Molecular Weight 36 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Total IgG Protein A purified
Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HMGCL antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Cancer, Metabolism, Amino Acids
Restrictions For Research Use only

Alternatives

Alternatives for antigen "3-Hydroxy-3-Methylglutaryl-Coenzyme A Lyase (HMGCL)", type "Antibodies"
Hosts Rabbit (9), Mouse (3)
Reactivities Human (11), Mouse (Murine) (5), Rat (Rattus) (5)
Applications Western Blotting (WB) (6), Flow Cytometry (FACS) (5), Immunofluorescence (IF) (5), Enzyme Immunoassay (EIA) (2), ELISA (1), ELISA (Detection) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), PE,Cy5.5 (1)