SLC22A1 antibody

Catalog No. ABIN630301

This Rabbit Polyclonal antibody specifically detects SLC22A1 in WB and IHC. It exhibits reactivity toward Human.

Quick Overview for SLC22A1 antibody (ABIN630301)

Target: SLC22A1 (Solute Carrier Family 22 (Organic Cation Transporter), Member 1 (SLC22A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC22A1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-SLC22A1 Antibody

Purification: Purified

Immunogen: SLC22 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IAIQMICLVNAELYPTFVSGVGPACRGSDATSSRDQGGRFARDHEGRREP

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC22A1 Blocking Peptide, (ABIN939278), is also available for use as a blocking control in assays to test for specificity of this SLC22A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC22A1

Target: SLC22A1 (Solute Carrier Family 22 (Organic Cation Transporter), Member 1 (SLC22A1))

Alternative Name: SLC22A1

Background: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Hormone Transport