SLC22A23 antibody (Middle Region)

Catalog No. ABIN630315

The Rabbit Polyclonal anti-SLC22A23 antibody (ABIN630315) specifically detects SLC22A23 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for SLC22A23 antibody (Middle Region) (ABIN630315)

Target: SLC22A23 (Solute Carrier Family 22 (Organic Cation Transporter), Member 23 (SLC22A23))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC22A23 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC22A23 Antibody

Binding Specificity: Middle Region

Specificity: SLC22 A23 antibody was raised against the middle region of SLC22 23

Purification: Purified

Immunogen: SLC22 A23 antibody was raised using the middle region of SLC22 23 corresponding to a region with amino acids VVLCVNSLTGYGIHHCFARSMMGHEVKVPLLENFYADYYTTASIALVSCL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC22A23 Blocking Peptide, (ABIN5616199), is also available for use as a blocking control in assays to test for specificity of this SLC22A23 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 23 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC22A23

Target: SLC22A23 (Solute Carrier Family 22 (Organic Cation Transporter), Member 23 (SLC22A23))

Alternative Name: SLC22A23

Background: SLC22A23 belongs to a large family of transmembrane proteins that function as uniporters, symporters, and antiporters to transport organic ions across cell membranes.

Molecular Weight: 45 kDa (MW of target protein)