SLC16A1 antibody

Catalog No. ABIN630329

The Rabbit Polyclonal anti-SLC16A1 antibody is suitable to detect SLC16A1 in samples from Human. It has been validated for WB.

Quick Overview for SLC16A1 antibody (ABIN630329)

Target: SLC16A1 (Solute Carrier Family 16, Member 1 (Monocarboxylic Acid Transporter 1) (SLC16A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC16A1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC16A1 Antibody

Purification: Purified

Immunogen: SLC16 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTIN

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC16A1 Blocking Peptide, (ABIN939982), is also available for use as a blocking control in assays to test for specificity of this SLC16A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC16A1

Target: SLC16A1 (Solute Carrier Family 16, Member 1 (Monocarboxylic Acid Transporter 1) (SLC16A1))

Alternative Name: SLC16A1

Background: SLC16A1 is a monocarboxylate transporter (MCT1) that mediates the movement of lactate and pyruvate across cell membranes Import and export of these substrates by tissues such as erythrocytes, muscle, intestine, and kidney are ascribed largely to the action of a proton-coupled MCT.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: Warburg Effect